PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G271000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 543aa    MW: 60037.6 Da    PI: 5.7971
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G271000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4301.9e-1311725411373
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++++++c +av+++d  +++ l+++l +l+s +gdpmqRl ay++e++ arl++s+s lyk+l+++e +    se +++++l++e++P++
  Sevir.9G271000.1.p 172 LKQVIIACGKAVAENDVFATELLISELGQLVSVSGDPMQRLGAYMLEGIVARLSSSGSMLYKSLKCKEPT---GSELMSYMHLLYEICPFY 259
                         57899****************************************************************9...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         kf+++ aN aI ea++ge+ vHiiDf+i qG QW++L+qaLa+Rp+gpp +RiTg+++++s   +   l  +g+rL+++A+++g+pfefn+
  Sevir.9G271000.1.p 260 KFGYMSANGAIAEAIKGENFVHIIDFQIAQGSQWITLIQALAARPGGPPYIRITGIDDSNSAyaRGGGLDIVGRRLHSVAQSCGLPFEFNA 350
                         **********************************************************988899999************************ PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          v  + ++++le+L+v+pgE ++Vn+++qlh+++desvs+e++rd++++++ks++P+vv++veqe+++n+++F+ r +e+l+yy+a+f+s+
  Sevir.9G271000.1.p 351 -VPAASHEVQLEHLAVRPGEIIVVNFAYQLHHVPDESVSIENHRDRIIRMIKSINPRVVTLVEQESNTNTAPFFPRYMETLNYYTAMFESI 440
                         .7999************************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         ++ lpr+++ r++ E+++++r+ivn++aceg er+erhe ++kW++r+ +aGF+p+pls+ +++++++llr ++s  y++ee++g l+lgW
  Sevir.9G271000.1.p 441 DVALPRDDRRRMSAEQHCVARDIVNLIACEGPERVERHELFGKWKARFAMAGFRPYPLSSVVNNTINTLLRSYNSC-YSLEERDGVLYLGW 530
                         **************************************************************************55.************** PP

                GRAS 363 kdrpLvsvSaW 373
                         k+r Lv+ SaW
  Sevir.9G271000.1.p 531 KNRVLVVSSAW 541
                         *********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.992146523IPR005202Transcription factor GRAS
PfamPF035146.5E-129172541IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MSARASNHPY KISNDSQMPY YSDSAPVGEN GRFHAMQNNL DHHYSSPDDG SQRINSSNTQ  60
VFEAQYCTLE SSSANGIYPA QSSTSSHSIS PLSGSPLSQH DGHSDHTYSS PPSASCLTEV  120
ADLQIKLKEL ENVILGPELD ITSDSPESFL QANVQLRPDN WRQLLGIDAG DLKQVIIACG  180
KAVAENDVFA TELLISELGQ LVSVSGDPMQ RLGAYMLEGI VARLSSSGSM LYKSLKCKEP  240
TGSELMSYMH LLYEICPFYK FGYMSANGAI AEAIKGENFV HIIDFQIAQG SQWITLIQAL  300
AARPGGPPYI RITGIDDSNS AYARGGGLDI VGRRLHSVAQ SCGLPFEFNA VPAASHEVQL  360
EHLAVRPGEI IVVNFAYQLH HVPDESVSIE NHRDRIIRMI KSINPRVVTL VEQESNTNTA  420
PFFPRYMETL NYYTAMFESI DVALPRDDRR RMSAEQHCVA RDIVNLIACE GPERVERHEL  480
FGKWKARFAM AGFRPYPLSS VVNNTINTLL RSYNSCYSLE ERDGVLYLGW KNRVLVVSSA  540
WC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-581745416374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8587660.0HQ858766.1 Zea mays clone UT1682 GRAS transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983228.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_004983229.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLK4A8460.0K4A846_SETIT; Uncharacterized protein
STRINGSi035052m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151337117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein